Why do you believe in the evolution theory?

[Oncedeceived]

No, I didn't realize that.



This is off topic for the forum.

He is just regurgitating the false information on atheist sites.

 

[justlookinla]

He is just regurgitating the false information on atheist sites.

Yep, they take the misinformation and run with it.

 

[crjmurray]

Yep, they take the misinformation and run with it.

Several circuit breakers blown

All fuses blown

Small electrical fires in Rooms A, D, G

Shards of glass all over the floor

Several technicians with minor injuries

All irony meters have blown

 

[Davian]

Several circuit breakers blown

All fuses blown

Small electrical fires in Rooms A, D, G

Shards of glass all over the floor

Several technicians with minor injuries

All irony meters have blown

lol. I don't bring my nice irony meters here anymore.

 

[ThinkForYourself]

You are aware that all these "false gods" were later than the writings of the Old Testament right? Have you researched this claim? I have and you are mistaken about numerous gods who have been resurrected and the virgin birth.

Some were before and some were after. Here are some pre-Jesus gods. There are also pre-Yahweh gods.

10 Christ-like Figures Who Pre-Date Jesus


And no, I'm not wrong about the virgin birth.

The Ancient Beginnings of the Virgin Birth Myth
"Therefore, we find that long before the Christian era there were already pictured -- in pagan places of worship -- virgin mothers and their divine children, and that such pictures included scenes of an Annunciation, an Incarnation, and a Birth and Adoration, just as the Gospels written in the second century A.D. describethem"


Anyways, this is clearly off topic. If you would like more information, feel free to send a pm.

 

[Blue Wren]

Why, would you not "believe" in the evolution theory, except for your interpretation, of Genesis?

 

[crjmurray]

Why, would you not "believe" in the evolution theory, except for your interpretation, of Genesis?

Ignorance. And then willful ignorance.

 

[AV1611VET]

Why, would you not "believe" in the evolution theory, except for your interpretation, of Genesis?

How about my interpretations of:

Exodus 20:11* For in six days the LORD made heaven and earth, the sea, and all that in them is, and rested the seventh day: wherefore the LORD blessed the sabbath day, and hallowed it.

Deuteronomy 4:32 For ask now of the days that are past, which were before thee, since the day that God created man upon the earth, and ask from the one side of heaven unto the other, whether there hath been any such thing as this great thing is, or hath been heard like it?

Mark 10:6 But from the beginning of the creation God made them male and female.

Mark 13:9 For in those days shall be affliction, such as was not from the beginning of the creation which God created unto this time, neither shall be.

... just to mention a few?

* From the Ten Commandments unbelievers want removed from public property.

 

[whois]

Why, would you not "believe" in the evolution theory, except for your interpretation, of Genesis?

there are a number of reasons.
first is HOX genes.
any mutation of these genes quickly lead to a non viable organism.
this implies each organism has a unique origin, it didn't mutate from something else.
second is, there is no evidence that inanimate matter becomes alive.
third is the charade and nonsense associated with this topic.
piltdownman is a classic example of this.
it took the scientific community 40 years to expose this hoax.

 

[lasthero]

piltdownman is a classic example of this.
it took the scientific community 40 years to expose this hoax.

That's not entirely accurate. Even when it was first presented, there were people who were quite skeptical of the claim. And this only increased as time went on and more fossils were found. Piltdown Man never really fit into the picture that was being painted by the evidence, which makes sense in retrospect.

Pretty much as soon as techniques were developed that were capable of exposing it, it was exposed. During that 40 years, Piltdown Man was barely mentioned at all in the scientific literature, and when it was, it was regarded as an oddity.

 

[Oncedeceived]

Some were before and some were after. Here are some pre-Jesus gods. There are also pre-Yahweh gods.

10 Christ-like Figures Who Pre-Date Jesus


And no, I'm not wrong about the virgin birth.

The Ancient Beginnings of the Virgin Birth Myth
"Therefore, we find that long before the Christian era there were already pictured -- in pagan places of worship -- virgin mothers and their divine children, and that such pictures included scenes of an Annunciation, an Incarnation, and a Birth and Adoration, just as the Gospels written in the second century A.D. describethem"


Anyways, this is clearly off topic. If you would like more information, feel free to send a pm.

Kersey Graves is not a reputable researcher and has been shown to use false material. You are regurgitating material that is false. I have researched the material and almost all of the claims of Jesus being a copy cat are completely false. What you and others do is throw out all this grouped together and hope the scope of the material is too daunting to go through. I've spent years on this material and spent hours upon hours researching the actual documentation on it. The sites that put this stuff up have not researched anything and just keep putting up the old and refuted material anyway.

 

[Mr Strawberry]

I have researched the material and almost all of the claims of Jesus being a copy cat are completely false.

Just out of curiosity, when you say you "researched the material" where did you look?

 

[sfs]

first is HOX genes.
any mutation of these genes quickly lead to a non viable organism.
this implies each organism has a unique origin, it didn't mutate from something else.

First, your statement is simply wrong. I just looked at one randomly chosen Hox gene cluster in the genome browser, and I see two nonsynoymous variants at appreciable frequencies in human populations. Second, Hox genes are indeed highly conserved. This means that change to them is difficult, not that it's impossible. If you compare the different clusters of Hox genes, you'll find that they look very much like the entire cluster has been duplicated; it turns out that these duplications usually coincided with whole or partial genome duplications that we have independent evidence for. Such events are rare, but not impossible.

second is, there is no evidence that inanimate matter becomes alive.

Not really relevant. If God (or aliens, or whatever) manufactured the first life, all the evidence still points to life being related by common descent since then.

third is the charade and nonsense associated with this topic.
piltdownman is a classic example of this.

It's also just about the only example of this.

 

[Loudmouth]

there are a number of reasons.
first is HOX genes.
any mutation of these genes quickly lead to a non viable organism.

sfs beat me to it . . . as you can see, there are mutations in the human population in HOX genes, and they are viable.

I wasn't quite sure if the mutations I was seeing in HapMap were in exons or introns, so I went a different route. I went to Homologene and compared the protein sequence between species. Here is the comparison for HOXA6 for human (query) and dog (subject):

Query 1 MSSYFVNPTFPGSLPSGQDSFLGQLPLYQAGYDALRPFPASYGASSLPDKTYTSPCFYQQ 60
--------MSSYFVNPTFPGSLPSGQDSFLGQLPLY AGYDALRPFPASYGASSLPDKTYTSPCFYQQ
Sbjct 1 MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQ 60

Query 61 SNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSGQG 120
---------SNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSS--G
Sbjct 61 SNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSSVPG 120

Query 121 KALHDEGADRKYTSPVYPWMQRMNSCAGAVYGSHgrrgrqtytryqtLELEKEFHFNRYL 180
----------KALHDEG DRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYL
Sbjct 121 KALHDEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYL 180

Query 181 TRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSEAKAGE 233
----------TRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGED+EAKAGE
Sbjct 181 TRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDAEAKAGE 233



As you can see, there are several non-synonymous mutations that seprate dogs and humans, and both are viable. If these genes can't change, then how do you explain the differences?

second is, there is no evidence that inanimate matter becomes alive.

You disprove this claim every time you eat.

third is the charade and nonsense associated with this topic.
piltdownman is a classic example of this.

Which one of these is Piltdown Man? Which one of these are you saying is a charade?

 

[Belk]

Kersey Graves is not a reputable researcher and has been shown to use false material.

Do you have a citation by chance? I like bookmarking these things for future reference.[/quote]

You are regurgitating material that is false. I have researched the material and almost all of the claims of Jesus being a copy cat are completely false.

No offense, but I think you might be biased.

What you and others do is throw out all this grouped together and hope the scope of the material is too daunting to go through.

Also known as the Gish gallop.

I've spent years on this material and spent hours upon hours researching the actual documentation on it. The sites that put this stuff up have not researched anything and just keep putting up the old and refuted material anyway.

What are your research credentials?

 

[Split Rock]

there are a number of reasons.
first is HOX genes. any mutation of these genes quickly lead to a non viable organism.

This has been shown by others to be simply incorrect.

this implies each organism has a unique origin, it didn't mutate from something else.

What do you mean by "organism" here? Every individual? Every species? Every family? Please be specific.

second is, there is no evidence that inanimate matter becomes alive.

Irrelevant.

third is the charade and nonsense associated with this topic.
piltdownman is a classic example of this.
it took the scientific community 40 years to expose this hoax.

And it is also the only example. Paleontologists learned from this and nowadays are on the look out for mosaic fossils and frauds.

Got anything else? Or should we use the baseball "three strikes and you're out" rule for you?

 

[Oncedeceived]

Just out of curiosity, when you say you "researched the material" where did you look?

I've researched what our local library has available and online sources. I've researched with books by many Egyptologists. I've looked at certain artifacts that contain myths about many of the claims used to discredit Jesus and His resurrection. I've checked to see where the claims arise and from what sources they stem from. Many of the claims are completely bogus and are no where to be found and others are based on misinterpretation.

 

[Oncedeceived]

Do you have a citation by chance? I like bookmarking these things for future reference.

This one should be acceptable to you.
ATTENTION: The scholarship of Kersey Graves has been questioned by numerous theists and nontheists alike; the inclusion of his The World's Sixteen Crucified Saviors in the Secular Web's Historical Library does not constitute endorsement by Internet Infidels, Inc. This document was included for historical purposes; readers should be extremely cautious in trusting anything in this book.

Sixteen Saviors Crucified

No offense, but I think you might be biased.

Indeed. I am. However, do you think that being biased means you can't look at information in an unbiased way?

Also known as the Gish gallop.

Seems this is not only seen in Gish.

What are your research credentials?

Are you claiming that certification is necessary for one to do research?

 

[selfinflikted]

Indeed. I am. However, do you think that being biased means you can't look at information in an unbiased way?

You cannot be biased and unbiased at the same time.

 

[JacksBratt]

Suicide bombers don't count as martyrs.

In fact, at one time, we tried to call them "homicide bombers," but I have a feeling someone complained.

Nice try though.

Care to retry, giving real martyrs the dignity due them?

Or, as I suspect, does this verse still apply today ...

Hebrews 11:38a ( Of whom the world was not worthy: )

... and you guys are prime validators?